How To Build And Host A Site From Scratch
Running a business without building a website is a very bad idea these days. That is because building a website is imperative for easily reaching millions in a fairly quick time. Building and hosting a website from scratch can be done in different ways. In this article, all of these techniques will be covered briefly.
Web Site Templates are a must-have thing for a website since it's the simplest (also quickest) way to design a site without spending much time or money. With a free website template, one can have a simply designed website at no cost at all. There are also paid templates which generally provide more professional and suave designs at a minimal cost. Although they take less time, they might lack in flexibility and uniqueness.
One should also consider ISP site builders while building a site. A few ISPs (Internet Service Providers) provide site building tools as part of their package and the best thing about them is that no knowledge of HTML is required here. However, the pages in sites created in this fashion cannot be individually optimized for search engines.
If one has the adequate time and learning ability, then he should definitely try learning HTML language which will enable him to build his own web site and have total control over any changes that are needed to be made. Although this method may seem discouraging due to the steep learning curve, it actually offers many facilities such as flexibility and control. One may also use HTML editors that will help him with writing/editing the HTML. The easiest editors, however, are the WHAT YOU SEE IS WHAT YOU GET (WYSIWYG) editors which are also capable of manipulating the HTML code. WYSIWYG editors are pretty expensive but on the contrary, it is the ultimate solution for total maintenance of one's website.
After the building phase is over, one needs to register a domain name and then find a host. One's domain name should always reflect the theme of his web site if he wants searchers to find it. Domain names unequivocally help in describing the content of one's site. Many of the search engines put lots of emphasis on one's domain name when they display search results, so it's important to the your keywords within if possible. Although the registration cost of a domain was above thirty/forty dollars, it has come down significantly lately. After the registration, one does not have to do much with the domain registrar except transfer his domain name to the hosting company that he picks. Some domain registrars even offer hosting which simplifies the whole process. The Web hosting India companies usually offer space for the web pages, multiple email accounts and a bandwidth (traffic) limit. Although monthly hosting fees may range from zero to a thousand dollars, a beginner should not need to pay more than ten dollars per month. Free hosting companies are not recommended since they do not offer very helpful services.
Companies can also be benefited financially by having a website. Small-scale companies can display tiny advertisements of other companies in their web page to make money. These advertisements are too small to notice, yet they have the capability to draw a lot of money for the website-owner company. A company can also place vital payment information in their website which will let the visitors know how to pay in case a transaction occurs. Some companies even offer the customers a very easy payment procedure through the website which is getting popular day by day.
Previous Next
See also
go to my yahoo mail inbox yahoo mailtarget coupons target storestarget baby registry last namelove calculator frivyoutube videos blackjobs2careers phone numberyahoo mapssateliteviewsateliesearswikipedia logo transparentmsn news headlines todaycircuit city bankruptcy claimswindows internet explorer for macgoogle drive windows 10americanexpress.comgoogle earth windows 10free credit report government issuedasd google docspaypal customer service telephone numberhealth insurance plans in ny statenn10 best credit cardsmsn hotmail sign in page msn hotmail accountiphone 7 release date wikicheap hotels near minute maid park houstoncingular wirelesscheap tickets to orlando studioscingular phones freemaps and driving directions msncitibank costco foreign transaction feebiking directions google mapsblockbuster on demand movies